View Full Version : Long words
Alden
January 27th 2003, 04:44 AM
I personally am enamored with:
Sentimentalization, substitutablility, ranunculaceous, proboscidiferous, and lectisternium.
Y'all got any favorites?
truthman
January 27th 2003, 05:20 AM
transubstantiation
but then that really doesn't have anything to do with archaeology but more with cannibalism
truthman
Solly
January 27th 2003, 05:35 AM
smiles is the longest word I like, since there is a mile between the first and last letter. :rofl:
GrayPilgrim
January 27th 2003, 10:15 AM
And I though infralapsarianism was a fun word, but it only has one lap between the beginning and end.
Solly
January 27th 2003, 10:28 AM
and it ends in arianism. Bad doctrine, see.
GrayPilgrim
January 27th 2003, 10:58 AM
Guess your right ;)
Lizard
January 27th 2003, 02:12 PM
Originally posted by Solly
smiles is the longest word I like, since there is a mile between the first and last letter. :rofl:
:hrm:
Patroclus
January 27th 2003, 02:47 PM
I like "Baldersnatch." It sounds comical, but it is oh, so wrong!
Revolg
January 27th 2003, 05:01 PM
Can't wait to get to full leveled debates on the crazy ideas within Creation and Evolution again! Even though I didn't participate as much. :hi:
$cirisme
January 27th 2003, 06:48 PM
Originally posted by Revolg
Can't wait to get to full leveled debates on the crazy ideas within Creation and Evolution again! Even though I didn't participate as much. :hi:
I used to be a big evolutionist debator.
I'm looking forward to (hopefully) getting into that again. :thumb:
MJCoate
January 28th 2003, 12:29 PM
How about: antidisestablishmentariansim ?
I don't know if it would count, since it was popular only in the sixties.
Alden
January 28th 2003, 02:06 PM
I will top you all!!:p
Chargoggagoggmanchauggagoggchaubunagungamaugg-reference to a lake near webster, mass
lopadotemachoselachogaleokranioleipsanodrimhypotrimmatosilph-ioparaomelitokatakechymenokichlepikossyphophattoperisteralektryonoptekephalliokigklopelei olagoiosiraiobaphetraganopterygon- 189 letters; a ghoulash composed of all the leftovers from the meals of the leftovers from the meals of the last two weeks from Aristophanes' The Ecclesiaszusae.
And yes, these are real. For all the unbelievers, check out:
Josefa Heifetz Byrne, Mrs. Byrne's Dictionary of Unusual, Obscure, and Preposterous Words. Secaucus, NJ: University Books, 1974;
Yog^sothoth
January 28th 2003, 03:27 PM
uniformitarianism
catastophism - seems small by comparison.
i'll give you a nickle if ya guess what they are!:thumb:
Em7add11
January 28th 2003, 03:56 PM
There's also:
Pnuemenoultamicroscopicsilicovolcaniconiosis
I'm not 100% sure on the spelling, cause the dictionary that I found that word in has long since fallen apart and been thrown away.
It's a disease similar to black-lung, only it's caused by microscopic bits of volcanic ash after an eruption. *cough*
Pate
January 28th 2003, 04:55 PM
"Epiphenomenalism" is one of my favourites. :)
"Anti-supernaturalistic presupposition" is also a good term to use in chat debates etc.
uber_loser
January 30th 2003, 05:01 PM
I'm reminded of when I saw a gameshow with highschool students. The question was "what does T.N.T. stand for?" They of course replied " Turner Network Televiesion" :no: which leads me to my favorite long word trinitrotoluene which is of course what T.N.T. really stands for.:thumb:
Revolg
January 30th 2003, 08:37 PM
Ornithological - Shape of bird...
Sorry, I don't know many long words.. What about Yeshua? haha
Bill the Cat
April 10th 2003, 03:28 AM
Llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch
This is the name of a town in North Wales. The name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave" in Welsh, has long claimed the fame of having the longest name in the world. However, there is a hill in New Zealand called:
Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu
This Maori mouthful translates into English as "the place where Tamatea, the man with the big knees, who slid, climbed and swallowed mountains, known as 'landeater,' played his flute to his loved one." I consider this a lean short-story, however, and have serious reservations about giving New Zealand the gold since local history has it that the parts about the knees and climbing mountains were recently added just to pull ahead of Llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch. But you may count it if you like now that Gavin Kingsley has offered photographic evidence of this claim, too.
However, before you make up your mind, consider the favorite of the Guinness Book of Records, the name of Bangkok (Krungthep) in Thai:
Krungthepmahanakonbowornratanakosinmahintarayudyaya-
mahadiloponoparatanarajthaniburiromudomrajniwesmahasatarn-
amornpimarnavatarsatitsakattiyavisanukamphrasit
The translation here is pretty much the unabridged history of the city rather than a word.
krungthep mahanakhon
The land of angels, the great city of
amorn rattanakosin
immortality, various of devine gems,
mahintara yudthaya mahadilok pohp
the great angelic land unconquerable,
noparat rajathanee bureerom
land of nine noble gems, the royal city, the pleasant capital,
udomrajniwes mahasatarn
place of the grand royal palace,
amorn pimarn avaltarnsatit
forever land of angels and reincarnated spirits,
sakatattiya visanukram prasit
predestined and created by the highest devas.
truthman
March 3rd 2004, 03:04 PM
FLOCCINAUCINIHILIPILIFICATION
Definition = The estimation of something as valueless
as in: The FLOCCINAUCINIHILIPILIFICATION process of this thread.
Chuck Lee
March 3rd 2004, 03:57 PM
Chemiosmotic phosphorylation.
It's actually a fairly common Biology term. Biologists need to learn to keep terms simple, like physicists.
Roy
March 3rd 2004, 04:08 PM
I will top you all
Not enough time to type the really sesquipedalian ones? Suffering from hippopotomonstrosesquipedaliophobia? Not wishing to obtain honorificabilitudinitatibus? Depressed by thoughts of pneumonoultramicroscopicsilicovolcanoconiosis? Or too busy banging your zzxjoanw?
Roy (who has a slight yearning to outdo Solly as well, but can't work out how...)
Roy
March 3rd 2004, 04:10 PM
Chemiosmotic phosphorylation.
It's actually a fairly common Biology term. Biologists need to learn to keep terms simple, like physicists.
If I was a physicist I'd resent that remark.
Roy
Chuck Lee
March 5th 2004, 11:45 AM
If I was a physicist I'd resent that remark.
Physicists like to keep things simple, if sometimes weird. Take quarks for example. TYpes of quarks? Charmed, up, down...
I'm trying to think of complicated physics terms and drawing blanks. Complicated formulae yes, terms no.
vBulletin® v3.6.12, Copyright ©2000-2009, Jelsoft Enterprises Ltd.